PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr015225.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRF
Protein Properties Length: 331aa    MW: 36566.1 Da    PI: 8.3482
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr015225.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.23.9e-2580124145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e 
  Pbr015225.1  80 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV 124
                  79****************************************985 PP

2QLQ55.81.4e-191545232
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32
                 +FTa+Q+q+L++Q+l++Ky+a+++P+P +L+
  Pbr015225.1 15 PFTATQWQELEHQALIFKYMASGVPIPNDLV 45
                 9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.4E-101450IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.2E-141545IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.5241550IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.32580124IPR014977WRC domain
PfamPF088792.9E-2181123IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MMSGNPSSAA RNRYPFTATQ WQELEHQALI FKYMASGVPI PNDLVYSFKR RLDSSISSRL  60
FPHHPMGWGC YEMGFGRKVD PEPGRCRRTD GKKWRCSKEA YPDSKYCERH MHRGRNRSRK  120
PVEVSSSSSA LSSPTAASTA TAEHLSSPSA TSPSSSSLHR NLCKTSSSSY TLAPLSSSIS  180
TQQTHQSNSS LYPFLNYPYS SSSSSSAPQL FLNSASYSDK DYRYLQGAKE GVDELAFFPD  240
SSADERNLLM NSYRGYSPTQ QSQEDQQQHC FVWGTDFKSV QTEKESAAAA AAAESQKSLH  300
HFFGEWQQPT KSSGDTWLDL ASNSGGPNDG *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7700700.0KC770070.1 Pyrus pyrifolia microsatellite TXY185 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009372336.10.0PREDICTED: growth-regulating factor 5 isoform X2
TrEMBLM5XAI31e-136M5XAI3_PRUPE; Uncharacterized protein
STRINGGLYMA07G04290.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-61growth-regulating factor 5